Some times it’s the most boring endevor. 

I put colcemid in my cell cultures to arrest cell division and I have to wait 2 hours before I can do anything else. 

It’s been 45 minutes. 

Good thing I have tumblr. 

The biotech program I’m in has been going very well.

I’m currently working on my second capstone, which includes erythrocyte culturing and karyotyping because my family has a strange chromosomal abnormality that doesn’t have any sort of phenotypic outcome. Even though it is a significant translocation. 

I also applied for a summer internship, that would actually be paid.

MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHN
VGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSC
EPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALR
MKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYL
LTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

• Memory T-Cell: Recognizes invading antigens from a previous exposure.
• Killer T-Cells: Destroys antigens
• Suppressor T-Cell: Suppresses antibody formation. Prevents immune system from getting out of hand. 
• Helper T-Cell: Helps where it is need. Can act like a memory, killer or suppressor cell. Stimulates B-cells to produce more antibodies.

• Thymus gland produces T-Cells. T-Cells fight viral/fungal/protozoa infections.
• Bone Marrow produces B-Cells. B-Cells fight bacterial infections and viral infections in the blood.

When the body’s immune system reacts and preforms as it should.

Have been rather disappointing. 

Not in that ways that I’m not learning anything, I have been learning plenty of new material that I didn’t know before, but at the same time a lot of it for me has just been refreshers. Which I have my high school biotech program to blame for that. 

This term at school I was in my Advanced Techniques for biotechnology course, which I was excited about initially. I was ready to learn new ways to use lab equitment and be taught how to use things I had never used in the past, but as the class started I soon found out that everything I was going to learn in that class I was taught in high school.

It wasn’t a bad thing that I got to redo all of these things, but all of the labs we did in class I had done in high school, they were literally from the same company and the same kit. To name a few, extracting our own DNA, identifying genetically modified genes in corn products and ALU gene typing. 

I suppose I was expecting something more, being a college class. Although, I guess not everyone else in the class had the blessing to have such an advanced biotechnology class in their high schools. (And I have to take into consideration that I’m the youngest of my class at 19 and the oldest is somewhere in his 50’s.)

I have been able to help the other people in the class, with the basics, just as how to micropipet and make the correct percent gels, and how to decipher what the protocols for the lab means. And I have also developed a great relationship with my professor since we were able to talk on a more serious level than most of the other people in the class. 

I suppose I was just expecting more. Which is also why I haven’t been posting as much, it would really just be me repeating myself from things I’ve said in the past. So I’m hopefully that next term in my Protein Analysis for biotechnology I’ll get to learn new techniques that I have yet to do. 

I’m also taking Human Diseases next term as well, so that will also be something to look forward too. 

In light of a assignment at school project, I would like to extend a tutoring chance to my followers and the other users of Tumblr, for high school and college students.

The topics that I could help with include:

• Genetics
• Biotechnology
• Basic Chemistry
• Biology
• Math: Algebra through Pre-Calculus

To contact me just send me a message to this Tumblr or my AOL account at: biotechxx

I also have skype at: biotech_x

The means of tutoring will be up to you, whether it is done through typing, voice chatting or video chat. 

The average high school tutoring costs 20-30 dollars a session and college ranges from 40-50. I would be more than happy to just charge of 10 dollars a session. Depending on the topic and grade level. This fee can be paid for over paypal. 

My experience, I’m a second year college student soon to get my associates degree in biotechnology. I’m transferring to Ohio State University to pursue their Molecular Genetics bachelor. 

Please, contact me with any questions.